Protein Info for Psest_2736 in Pseudomonas stutzeri RCH2

Annotation: Transposase and inactivated derivatives

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF01797: Y1_Tnp" amino acids 16 to 131 (116 residues), 23.9 bits, see alignment E=1.9e-09

Best Hits

KEGG orthology group: K07491, putative transposase (inferred from 76% identity to avn:Avin_33360)

Predicted SEED Role

"Transposase and inactivated derivatives"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN69 at UniProt or InterPro

Protein Sequence (176 amino acids)

>Psest_2736 Transposase and inactivated derivatives (Pseudomonas stutzeri RCH2)
MSRYRRARVPGATYFFTVNLLNRRSDLLVRHVDLLRETVRATRLRHPFHINAWVVLPDHM
HCVWTLPDGDADFALRWKVIKFAFARRLPKTEILTATQRSRGERGIWQRRYWEHLIQDER
DYRHHVDYVHRNPLKHGLVKRVADWPYSSFHRAVSAGVYPVNWCGEELEGFAGDAD