Protein Info for PGA1_c27220 in Phaeobacter inhibens DSM 17395

Annotation: putative gamma-butyrobetaine dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to BODG_RHILO: Probable gamma-butyrobetaine dioxygenase (mll1440) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K00471, gamma-butyrobetaine dioxygenase [EC: 1.14.11.1] (inferred from 75% identity to sit:TM1040_0333)

MetaCyc: 59% identical to (2-trimethylamino)ethylphosphonate dioxygenase (Leisingera caerulea)
RXN-21275 [EC: 1.14.11.72]

Predicted SEED Role

"FIG00919107: hypothetical protein"

MetaCyc Pathways

(2-trimethylamino)ethylphosphonate degradation (2/2 steps found)
γ-butyrobetaine degradation II (1/1 steps found)
L-carnitine biosynthesis (2/4 steps found)

KEGG Metabolic Maps

Lysine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.11.1 or 1.14.11.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E3Q6 at UniProt or InterPro

Protein Sequence (381 amino acids)

>PGA1_c27220 putative gamma-butyrobetaine dioxygenase (Phaeobacter inhibens DSM 17395)
MPSVTLAPAGDYLTLSHGASDMRFHAIWLRDNANDSDTRAEANGQRLIALRDIPADTTIA
EATLDGETLRLRFMPENKTVAYDLSWLQAHTYDKARPEKAGWLADGVETWDAGLMDGVPT
GDFAALEAGGAALGDWLGAVTRYGFGKVVNGPVEDGALFRVVDLFGHVRETNYGRHFEVR
TEVNPTNLAFTGLGLQAHTDNPYRDPVPTIQVLYCLESSAAGGENMVVDGFAAALRLKAE
NEAYFNVLAEHCARFEYAGEAGVCLTSRRPMIELAPDGELIGVRFNNRSLAAVQDVPFEK
MALYYAAYRRFGEIIDDTAMEVTFRLNPGEAFVVDNTRVLHARKGYSGEGTRWLQGCYAD
KDGLRSVYDARRRQALAEAAE