Protein Info for Psest_2729 in Pseudomonas stutzeri RCH2

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details PF00672: HAMP" amino acids 255 to 303 (49 residues), 40 bits, see alignment 6.1e-14 PF00512: HisKA" amino acids 309 to 373 (65 residues), 50.3 bits, see alignment E=3.1e-17 PF02518: HATPase_c" amino acids 423 to 529 (107 residues), 85.4 bits, see alignment E=5.6e-28

Best Hits

KEGG orthology group: K07639, two-component system, OmpR family, sensor histidine kinase RstB [EC: 2.7.13.3] (inferred from 92% identity to psa:PST_1639)

Predicted SEED Role

"Sensory histidine kinase in two-component regulatory system with RstA" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMJ7 at UniProt or InterPro

Protein Sequence (533 amino acids)

>Psest_2729 Signal transduction histidine kinase (Pseudomonas stutzeri RCH2)
MNSIFLRIYGGMLGVLVLVALLGAGGLHLLNQSRADDHRERLASGTFRLMAHNMSSMTPI
ERRQAANLWGRLLGIPLRVRTLDDVRLESRLEARLLRGQVLVEQIRPQSTTVFSLVSARD
RLVLTGEVEQLSEQLARATIYLLIDELIRYPEAEQPQRLAELKQARGFGFDLELLTRDSA
NLDDDQRRRLDEGDTVMALAQGGDAIRVFAAIAGTGWIMQLGPLYQMNPYPPQLLILIGL
LGLSLIGLTVYLLVRQLEQRLSVLEGAATRIAAGNLETRVPDVGTDSVGRLAAAFNGMAR
HLQRLLAVQREMVSAVAHELRTPVARLRFGLEMSAEAQTDEARRKYLEGMDGDIDDLDAL
VDEMLVYSRLERGSPTLNFQQVDLRALVDQVIGELAPLRPDVSVRRGECTTAADGSCWAE
AEPQYLRRALSNLINNAMRHAESRVQVSFAIEGQTVRLDVDDDGPGVPEADWEKVFTPFL
RLDDSRTRASGGHGLGLSIVRRIIYWHSGRSQLSHSELGGARFSLVWPRHRPD