Protein Info for HP15_2613 in Marinobacter adhaerens HP15

Annotation: protein belonging to uncharacterized protein family UPF0029

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 TIGR00257: uncharacterized protein, YigZ family" amino acids 1 to 189 (189 residues), 173 bits, see alignment E=2.8e-55 PF01205: UPF0029" amino acids 19 to 126 (108 residues), 135.7 bits, see alignment E=6e-44 PF09186: DUF1949" amino acids 144 to 187 (44 residues), 35.9 bits, see alignment 5.5e-13

Best Hits

KEGG orthology group: None (inferred from 71% identity to maq:Maqu_2867)

Predicted SEED Role

"FIG000605: protein co-occurring with transport systems (COG1739)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJL3 at UniProt or InterPro

Protein Sequence (201 amino acids)

>HP15_2613 protein belonging to uncharacterized protein family UPF0029 (Marinobacter adhaerens HP15)
MKKDYPVPAGYLERETEVKKSRFIARVAPVSSREEVKDWLEQAHQDHPDARHICWAYQIG
RPGSAAEAGMNDDGEPSGTAGKPILNVIQHKDMGDVLVMVVRYFGGIKLGAGGLVRAYAG
AAESVLSAVDRVVQKPMVDVLVLLSFADEQPLRHWCEMNGASVESVDYGASVRAGVLVPE
DQVEAFGAFCDAHKLDYSLER