Protein Info for PGA1_c27040 in Phaeobacter inhibens DSM 17395

Annotation: Predicted permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 34 to 51 (18 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 292 to 319 (28 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 321 (308 residues), 118.5 bits, see alignment E=1.9e-38

Best Hits

KEGG orthology group: None (inferred from 57% identity to dsh:Dshi_4175)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZM0 at UniProt or InterPro

Protein Sequence (340 amino acids)

>PGA1_c27040 Predicted permease (Phaeobacter inhibens DSM 17395)
MLNSMLSDRAARIMLLIVTALALGLALFFAKPVLAPVIFAVVVGIVVSPLADRLQGIGVA
RVIVAASLLLFSCAIIVLLFLSLEPLISGVVEDLPKIKQEIKSWVYMMSGLLRGIEAISQ
EIEQTVGTGATGPDVSTGFPTLMDALWVAPNFGAQVFIFIGTLFFFVLTRTDIYAAAGSL
GKRLYRAEHEVARYFAAVTLVNAGLGVATAIGLATLGINSALIWGLAAMLLNFILYLGPL
MMITGLTFVGMTQLGGAAALMPPALFLALNLIEAQFVTPAFVGHQLHLSPLVVFLAIVFG
LWIWGPVGAIVALPVMLWIGQLLRSSAEARRLQGEENPTG