Protein Info for HP15_2606 in Marinobacter adhaerens HP15

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 796 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details amino acids 386 to 403 (18 residues), see Phobius details amino acids 409 to 427 (19 residues), see Phobius details amino acids 594 to 612 (19 residues), see Phobius details amino acids 618 to 634 (17 residues), see Phobius details amino acids 641 to 661 (21 residues), see Phobius details amino acids 667 to 688 (22 residues), see Phobius details amino acids 714 to 735 (22 residues), see Phobius details amino acids 746 to 768 (23 residues), see Phobius details PF03176: MMPL" amino acids 574 to 770 (197 residues), 70.4 bits, see alignment E=1.4e-23 PF00873: ACR_tran" amino acids 605 to 768 (164 residues), 31.1 bits, see alignment E=5.4e-12

Best Hits

KEGG orthology group: None (inferred from 52% identity to eba:p2A399)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJK6 at UniProt or InterPro

Protein Sequence (796 amino acids)

>HP15_2606 transporter (Marinobacter adhaerens HP15)
MISAFARSLSEFCIRHRVWVTAIIFVSTLLMALTLLKIDVRTVFSDMVPSDHEYVDVHET
YKDTFGGSNKVSILVQARDGDIMTQPILEEVKRITRELAKVSGVNPFQVVSLASRKLKSV
SASSMGIESVPLMWPDVPESDAGIEALREAIINNPLVYGIYVEPDLSSTLIQMDFYDHLV
DYSKIFPQVQGILDASPVADQVTHHVVGEPILYGWVDFYLDETVSIALISLGAMLFALFL
LNRTWRGTLLPLLSGVVSTIWALGIGVLLGFNFDPLVIVVAFIITARCFSHAVQLITRFD
DLCDGEGVEPRKAAEQTMKELFRPGLLGLVSDAGAILCVVLTPIPLLQKVSIIGAIWVMT
IGFSAVILTPVLLSWVKAPLRNAHPLNLRFLLNAVLSVAVKVVETRARFFVLPVTLILVA
ALVFKATDLTIGDATTGSPILWEDSQFNRDSALINANYPGTEQMFVVLEGEKEDALKRPD
VLAWMQGFQRRMERLPSVGGSVSLADIVVDVRRNLYEGNPRYRELGATQLENGELISFYM
QGAAPDDLAQFADPLFQNGSVILFFRDRQGETLRHATYQIRRYIEENPLEGVDVRLAGGS
LGIIAAVNEILLSDQIEAIALALLVVILSCLAVYRSSASGIFFIVPVLISNVVTFAFMAW
QGIGMSISTLPVVALGIGLGVDYAFYIVDSVKEYLEKDPGADPMDAIRQSLFSAGRGVLL
TSVTLAAGVLFWSLSSLRFQAEMGTLIGLWLLVSAFTSLFVMPSLVRVLKPKFIFGDRPV
KAESDQGMERLAQSTH