Protein Info for Psest_2712 in Pseudomonas stutzeri RCH2

Annotation: Surface lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF04333: MlaA" amino acids 32 to 221 (190 residues), 258.6 bits, see alignment E=1.8e-81

Best Hits

KEGG orthology group: K04754, lipoprotein (inferred from 95% identity to psa:PST_1656)

Predicted SEED Role

"VacJ-like lipoprotein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPB3 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Psest_2712 Surface lipoprotein (Pseudomonas stutzeri RCH2)
MPKIATAWIAVLKAGFVATVAMLGAAPALAEEDPWEGVNRAVFRFNDTVDTYTLKPLAKG
YQKVTPEFVEDGIGNVFSNLGDVIVLTNDLLQGKVRDAGIDTSRILFNTTFGVLGFFDVA
TRMGLHKNDEDFGQTLGAWGLGSGPYVVLPLLGPSTVRDAFGRVPDSFLEPYPHMEHVPT
RNVTRGVDLVDTRAGLLSAEKMIRGDRYIFVRNAYLQNREFRVKDGEVEDDF