Protein Info for PGA1_c26950 in Phaeobacter inhibens DSM 17395

Annotation: putative exopolysaccharide synthesis protein ExoD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 45 to 71 (27 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details PF06055: ExoD" amino acids 10 to 185 (176 residues), 140.9 bits, see alignment E=1.5e-45

Best Hits

KEGG orthology group: None (inferred from 47% identity to sit:TM1040_2725)

Predicted SEED Role

"Exopolysaccharide synthesis, ExoD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E3N8 at UniProt or InterPro

Protein Sequence (193 amino acids)

>PGA1_c26950 putative exopolysaccharide synthesis protein ExoD (Phaeobacter inhibens DSM 17395)
MTAENQPVAEMIDATTELLEEDSISVADVVEDLGHSSMSATLLLPAMAVVSPLSGVPLFS
TICGMLIFLIAGQMALGRDHLWLPDWLRRQRVSSDRARKVLGPMRRMARFLDRHTEARVK
ILLRQPFLTVPRVICALCGLAMPFLELVPFSSSTLGIVVSSLAVAMLTRDGLVMLVALLL
LTAAGVGLPYLLI