Protein Info for Psest_2703 in Pseudomonas stutzeri RCH2

Annotation: ATPases involved in chromosome partitioning

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF10609: ParA" amino acids 5 to 244 (240 residues), 70.2 bits, see alignment E=4.9e-23 PF13614: AAA_31" amino acids 5 to 163 (159 residues), 69.4 bits, see alignment E=9.8e-23 PF06564: CBP_BcsQ" amino acids 5 to 150 (146 residues), 31.2 bits, see alignment E=4.2e-11 PF01656: CbiA" amino acids 7 to 220 (214 residues), 45.1 bits, see alignment E=2.3e-15

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 61% identity to pba:PSEBR_a1497)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN39 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Psest_2703 ATPases involved in chromosome partitioning (Pseudomonas stutzeri RCH2)
MNPVQVIAVTGGRGGCGKTNVSVNLALGLAALGRRVMILDADLALANAHVLLGLASKQTV
ADVLRGTCSAEQAMLSFKGNVRLLPGTCGDLSMAHLTATQQAGLIHAVSDIRDTPDVLII
DTASGISDSTMNFIRASRQVLVVITDEPASFNGAYNLIKLLNRNYGINHFHVLANMTRTP
HEGRALFSRMVQITDRFLSVVLDYLGDVPFDESVRTAAHKRRAVFEAYPKSKCAVAYQKL
AKKVDEWPLPVYPRAHLEFFGDNLLNPALERLAS