Protein Info for Psest_0266 in Pseudomonas stutzeri RCH2
Annotation: thiamine biosynthesis protein ThiS
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 32% identical to THIS_BACSU: Sulfur carrier protein ThiS (thiS) from Bacillus subtilis (strain 168)
KEGG orthology group: K03154, sulfur carrier protein (inferred from 80% identity to ppw:PputW619_0360)MetaCyc: 32% identical to ThiS sulfur carrier protein (Bacillus subtilis subtilis 168)
Predicted SEED Role
"Sulfur carrier protein ThiS" in subsystem Thiamin biosynthesis
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GGI9 at UniProt or InterPro
Protein Sequence (66 amino acids)
>Psest_0266 thiamine biosynthesis protein ThiS (Pseudomonas stutzeri RCH2) MQIQLNGEPYELPAGETVADLLVRLELSGRRLAVELNRDIVPRSAHASTALSEGDYVEVV HAIGGG