Protein Info for PGA1_c26880 in Phaeobacter inhibens DSM 17395

Annotation: putative iron transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 26 to 61 (36 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 121 to 167 (47 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 212 to 240 (29 residues), see Phobius details amino acids 268 to 298 (31 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details amino acids 338 to 356 (19 residues), see Phobius details PF01032: FecCD" amino acids 36 to 358 (323 residues), 306.5 bits, see alignment E=9.2e-96

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 76% identity to rde:RD1_3479)

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZK8 at UniProt or InterPro

Protein Sequence (359 amino acids)

>PGA1_c26880 putative iron transport system permease protein (Phaeobacter inhibens DSM 17395)
MSTAHAHPATEPRLSARARRRLRGRLAWILSGAVLTALTLSIAVSVGAVGIPLTAVWGII
VSKLAPGLENWFTTDWSKGQAAIVWDIRFPRALLAMMVGAGLAMVGASLQAVTRNPLADP
HLLGISAGGAFGAILALLHTGLFLGLLTVPLLAFAGALGATALVLAVSRFAEATTADRLV
LVGVAVSFVVMAGANVLIFLGDPRATHTVVFWMLGGLGLAQWSHLIYPLVVLVLCGGWLW
TKAGDFNAMTVGDETATTLGIPVARFRLITFTIGALITGVMVAFSGMIGFVGLIVPHIAR
LIVGGDHRRVLPASALIGGLFLVAADILARTLMAPEDMPIGLVTGLVGGVFFIWLLRRR