Protein Info for PGA1_c26830 in Phaeobacter inhibens DSM 17395

Annotation: phenylacetic acid degradation protein PaaZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02278: phenylacetic acid degradation protein paaN
  • amino acids 6 to 675 (670 residues), 996.4 bits, E=2.8e-304
• PF00171: Aldedh
  • amino acids 33 to 504 (472 residues), 208.1 bits, E=2e-65
• PF01575: MaoC_dehydratas
  • amino acids 547 to 651 (105 residues), 78.2 bits, E=4.2e-26

Best Hits

KEGG orthology group: K02618, phenylacetic acid degradation protein (inferred from 81% identity to sil:SPO0735)

Predicted SEED Role

"Phenylacetic acid degradation protein PaaN, ring-opening aldehyde dehydrogenase (EC 1.2.1.3)" (EC 1.2.1.3)

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• hypotaurine degradation (3/3 steps found)
• phytol degradation (3/4 steps found)
• ethanol degradation III (2/3 steps found)
• octane oxidation (3/5 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• mitochondrial NADPH production (yeast) (2/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (4/8 steps found)
• putrescine degradation III (1/4 steps found)
• serotonin degradation (3/7 steps found)
• dopamine degradation (1/5 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• limonene degradation IV (anaerobic) (1/7 steps found)
• aromatic biogenic amine degradation (bacteria) (1/8 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.3

Sequence Analysis Tools

See I7EZK5 at UniProt or InterPro

Protein Sequence (676 amino acids)

>PGA1_c26830 phenylacetic acid degradation protein PaaZ (Phaeobacter inhibens DSM 17395)
MSLLDVSSFAAGQWIAPGAGARSIASAITGAPLAQAGNDALDVQGMLDYARTVGGPSLRK
LTFHDRARMLKALAGHLNQHKQALYDLSFNTGATQSDHMIDIDGGIGTMFVFASKGRREM
PDAHVYLDGDIEQLSRNGTFLGQHICTPLQGVAVHINAFNFPVWGMLEKLAPTLLAGVPA
IVKPATATCYVTELAVRLMLESGILPEGALQLVSGGLGDMLDHLTMQDVVSFTGSAQTAL
KLRANPVILENSIRFVAEQDSLNASILGPDAGPGTPEFDLFVKEVSREMTTKAGQKCTAI
RRIIAPDAQVEAVIEALSARLAKTRIGDPRLETTRMGALVSNSQKRDVLEKAAIIGQEAE
RVFGDPENFSVDGADAEKGAFVPPMLFHCADPDKAQRVHDTEAFGPVSTIMGYHDLDHAI
TLANRGEGSLVASVITHDTEVAREVALGAGAYHGRLYFNNRDSMKESTGHGSPLPHMVHG
GPGRAGGGEELGGVRGVKHYMQRTAIQGSPDILSAIGEQWVPGGTEIAAKVHPFTRKFGD
LELGETLHSAARQITLEDIETFAHFTGDTFYAHMDDEAAARNPFFPGRVAHGYLLISFAA
GLFVQPDEGPVLANTGLDNLRFMKPVSAGDSIKVRLTVKKKTPRNEDYGQVRWHVTLTNQ
DDEIAAEYELLTMNAF