Protein Info for PGA1_c26810 in Phaeobacter inhibens DSM 17395

Annotation: phenylacetic acid degradation protein PaaI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 TIGR00369: uncharacterized domain 1" amino acids 22 to 129 (108 residues), 75.8 bits, see alignment E=3e-25 TIGR02286: phenylacetic acid degradation protein PaaD" amino acids 22 to 133 (112 residues), 140 bits, see alignment E=3.7e-45 PF03061: 4HBT" amino acids 50 to 124 (75 residues), 50 bits, see alignment E=1.5e-17

Best Hits

Swiss-Prot: 42% identical to PAAI_ECOLI: Acyl-coenzyme A thioesterase PaaI (paaI) from Escherichia coli (strain K12)

KEGG orthology group: K02614, phenylacetic acid degradation protein (inferred from 84% identity to sil:SPO0741)

MetaCyc: 42% identical to phenylacetyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-; 3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein PaaD, thioesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F201 at UniProt or InterPro

Protein Sequence (141 amino acids)

>PGA1_c26810 phenylacetic acid degradation protein PaaI (Phaeobacter inhibens DSM 17395)
MTPKDRAEKSAATMWANDHASKWAGMEITHVDEGAATLELTIAQHHCNGHGICHGGVTFM
LADSAFAFACNSRNQATVAQHNVISFTAPGRLGDRLIATAHEVSLTGRSGIYDVTVTNQD
SQKIAEFRGFSRAIKGQLFDE