Protein Info for Psest_2692 in Pseudomonas stutzeri RCH2

Annotation: catechol 1,2-dioxygenase, proteobacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02439: catechol 1,2-dioxygenase
  • amino acids 8 to 292 (285 residues), 470.6 bits, E=6.9e-146
• PF04444: Dioxygenase_N
  • amino acids 29 to 95 (67 residues), 77.6 bits, E=5.3e-26
• PF00775: Dioxygenase_C
  • amino acids 105 to 293 (189 residues), 245.4 bits, E=2.8e-77

Best Hits

Swiss-Prot: 57% identical to CATA_ACIAD: Catechol 1,2-dioxygenase (catA) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K03381, catechol 1,2-dioxygenase [EC: 1.13.11.1] (inferred from 87% identity to psa:PST_1674)

MetaCyc: 65% identical to 4-methylcatechol 1,2-dioxygenase [multifunctional] (Pseudomonas reinekei)
1.13.11.M6 [EC: 1.13.11.M6]; Catechol 1,2-dioxygenase. [EC: 1.13.11.M6, 1.13.11.1]; RXN-10080 [EC: 1.13.11.M6, 1.13.11.1]

Predicted SEED Role

"Catechol 1,2-dioxygenase (EC 1.13.11.1)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 1.13.11.1)

MetaCyc Pathways

• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• catechol degradation to β-ketoadipate (4/4 steps found)
• superpathway of salicylate degradation (6/7 steps found)
• aromatic compounds degradation via β-ketoadipate (7/9 steps found)
• 4-methylcatechol degradation (ortho cleavage) (5/7 steps found)
• 4-chlorocatechol degradation (2/5 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• chlorosalicylate degradation (1/7 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (11/35 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Carbazole degradation
• Fluorobenzoate degradation
• Toluene and xylene degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.1 or 1.13.11.M6

Sequence Analysis Tools

See L0GMG6 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Psest_2692 catechol 1,2-dioxygenase, proteobacterial (Pseudomonas stutzeri RCH2)
MTVKISQTSDVQNFFKEASGFGNDAGSSRMKTVINRILVDTAKIVEDLEITQDEFWKAVD
YLNRLGGRHEAGLLVAGLGLEHFLDLLEDAKDEQQGLTGGTPRTIEGPLYVAGAPISQAE
TRMDDGSELDVATVMFLQGQVTGPDGKPVANAVVDLWHANTKGNYSYFDKSQSEYNLRRR
IVTDENGNYRARSIVPSGYGCSLDGPTQEVLDHLGRHGRRPAHIHFFISAPGHRHLTTQI
NLAGDEYLWDDFAYATRDGLVGDIRFVEDAEAARARGIEGSRFAELTFDFQLQAAPAPEA
EQRSARPRALQNA