Protein Info for HP15_263 in Marinobacter adhaerens HP15

Annotation: thioesterase superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01643: Acyl-ACP_TE
  • amino acids 15 to 141 (127 residues), 38.1 bits, E=2.4e-13
• PF20791: Acyl-ACP_TE_C
  • amino acids 16 to 50 (35 residues), 23.2 bits, 1.3e-08
• PF13279: 4HBT_2
  • amino acids 20 to 141 (122 residues), 76.4 bits, E=5.3e-25
• PF03061: 4HBT
  • amino acids 29 to 92 (64 residues), 30.9 bits, E=5.8e-11

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 78% identity to maq:Maqu_0509)

Predicted SEED Role

"FIG002571: 4-hydroxybenzoyl-CoA thioesterase domain protein"

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

See E4PKY5 at UniProt or InterPro

Protein Sequence (153 amino acids)

>HP15_263 thioesterase superfamily protein (Marinobacter adhaerens HP15)
MQQHDIDWDLPAPFTIEIAVRPEDTDRLGHANNVVYVRWLEDVSWAHIESLGMTWELHEK
TGKAMAITRTEIDYLASANAGDQLVLGTWLTDYDGRFRSARQFQLVRPSDGKTLVRAVST
HACVDLKTQRPARAPKEFAEILGSAVVAGGKGL