Protein Info for PGA1_c26720 in Phaeobacter inhibens DSM 17395

Annotation: Predicted endonuclease distantly related to archaeal Holliday junction resolvase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF04471: Mrr_cat" amino acids 27 to 97 (71 residues), 22.3 bits, see alignment E=1.2e-08 PF02021: UPF0102" amino acids 29 to 118 (90 residues), 67.8 bits, see alignment E=8.9e-23

Best Hits

Swiss-Prot: 58% identical to Y400_RUEPO: UPF0102 protein SPO0400 (SPO0400) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K07460, putative endonuclease (inferred from 58% identity to sil:SPO0400)

Predicted SEED Role

"Predicted endonuclease distantly related to archaeal Holliday junction resolvase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F1Z5 at UniProt or InterPro

Protein Sequence (134 amino acids)

>PGA1_c26720 Predicted endonuclease distantly related to archaeal Holliday junction resolvase (Phaeobacter inhibens DSM 17395)
MAGRQGTPPRRASARGLGGAKSHHAGQAAEELVARHYERQGYQIAARRWRGGSAEIDLIL
RLGATVVFVEVKHSATRDQAMARINAAQMQRMMASAAQFLADEPAGQLTEARLDVAVVDG
TGRVEVLENAYGQG