Protein Info for PGA1_c26710 in Phaeobacter inhibens DSM 17395

Annotation: glutathione synthetase GshB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 TIGR01380: glutathione synthase" amino acids 1 to 309 (309 residues), 409.4 bits, see alignment E=4.3e-127 PF02951: GSH-S_N" amino acids 1 to 118 (118 residues), 140.2 bits, see alignment E=6.6e-45 PF02955: GSH-S_ATP" amino acids 122 to 293 (172 residues), 241.3 bits, see alignment E=9.2e-76 PF08443: RimK" amino acids 133 to 306 (174 residues), 71.7 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 59% identical to GSHB_BRUSU: Glutathione synthetase (gshb) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K01920, glutathione synthase [EC: 6.3.2.3] (inferred from 89% identity to sit:TM1040_0450)

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E3M1 at UniProt or InterPro

Protein Sequence (310 amino acids)

>PGA1_c26710 glutathione synthetase GshB (Phaeobacter inhibens DSM 17395)
MKIAFQMDPITDVDINADSSFRLAEEAQARGHSLFFYGPDQLAYQEGRITARGHDMTVQR
VAGTPAELGPRREVDLSDFDVVWLRQDPPFDMHYITSTHLLDRLKGQTLVVNDPFWVRNY
PEKLLVLDFPELTPPTTVARDLDTIKAFKEKHGDIILKPLYGNGGAGVFRLDANDRNLTS
LHELFTGFSREPLIVQKFLPDVSNGDKRVILVDGEPVGAINRVPAAGETRSNMHVGGRPE
KISLSDRDREICAAIGPLLREKGQVFVGIDVIGDYLTEINVTSPTGIQELERFDGVNIAE
KIWQAIESKL