Protein Info for HP15_2568 in Marinobacter adhaerens HP15

Annotation: permease of the major facilitator superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 62 to 82 (21 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 284 to 309 (26 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details amino acids 411 to 430 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 88% identity to maq:Maqu_2837)

Predicted SEED Role

"Permease of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIT1 at UniProt or InterPro

Protein Sequence (437 amino acids)

>HP15_2568 permease of the major facilitator superfamily protein (Marinobacter adhaerens HP15)
MPESRKDTIEQLYGLIANEEDARVCKDIPEEACREVPRNFFLILASNVLTKLGDLLISPK
TLLAWLMSAIGAPALVAWLVPIRESGSLVPQMVIAAWVRRKPVRKWFWTLGSFGQAASVV
AMAASVWFFEGYAAGFGIIAALIVFSLARGFCSVSMKDVQGKCIPKTRRGRLGGLASTIG
GTATVVLTSLLFWERGDPTIAFYTVLLLLAGALWVIAGFLFAGVQEHEGETGGGGNAINE
AFRSLSLLRDDVPFRNFVITRALLLCSALASPYFVVLAQKESDIGWMLGIFLLASSLASS
LSASFWGWAADTSSRRVMIRGAAMASGTCLIVGTAALTLGQDLGSVWFYPVAFFVLSIAH
AGVRLGRKTYLVDMAGGNKRTDYTAVSNTVIGVLLLVTGGLTALVSMISPVAVIMVLGLM
GLAGMFSAIRLKEVTED