Protein Info for Psest_2673 in Pseudomonas stutzeri RCH2

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 188 (177 residues), 33.7 bits, see alignment E=2e-12 amino acids 205 to 378 (174 residues), 55.3 bits, see alignment E=5.5e-19

Best Hits

KEGG orthology group: None (inferred from 95% identity to psa:PST_1691)

Predicted SEED Role

"transmembrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKB6 at UniProt or InterPro

Protein Sequence (435 amino acids)

>Psest_2673 Arabinose efflux permease (Pseudomonas stutzeri RCH2)
MKSLIAPISSLLAGVALLLLGHGLLNTLLTLRGVAEGYSTGMVGLLMSGYFAGFLIGTWL
APSLIRRIGHIRTFSFYASVAATAVLLHVMIVNPWVWLVLRVIYGVALVTLYMVIESWLN
AQVSGEKRGQVFAVYMAVNLGALAAAQQLLGLDSPMEFTLFALATILIGSAMMPITLTRQ
PQPSLPDIPPTDLLQLARIAPLPLMAAGISGFVLGGFWGLAPVYASEIGFDAAGVGLLMS
ITILGGAVLQWPIGLFSDKHERRTVLLWVVALAAVLALAVAPLLAGSLLLGLMFVWGGLA
FSIYSIAVAQMVDQLNPDEILSGSSGLLLANGFGAALGPVAAGGLMHLFGPIALPLFFAT
GLGVLAFYAFYRPRKVFDLVTEPHGHFTPILRTSPTVMELMPDTPEDATSQEPADESELD
DMPPAEAPTDMRTGT