Protein Info for PGA1_c26630 in Phaeobacter inhibens DSM 17395

Annotation: deoxyuridine 5'-triphosphate nucleotidohydrolase Dut

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 TIGR00576: dUTP diphosphatase" amino acids 13 to 150 (138 residues), 176.4 bits, see alignment E=1.3e-56 PF00692: dUTPase" amino acids 16 to 149 (134 residues), 111.6 bits, see alignment E=1.1e-36

Best Hits

Swiss-Prot: 74% identical to DUT_RUEPO: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 74% identity to sil:SPO0409)

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DTD9 at UniProt or InterPro

Protein Sequence (151 amino acids)

>PGA1_c26630 deoxyuridine 5'-triphosphate nucleotidohydrolase Dut (Phaeobacter inhibens DSM 17395)
MVEIRITYDEGADRDVPLPAYQTAEAAGADLRANLPDRRTLTLAPGARALVPTGLRLEIP
QGYEVQIRPRSGLALKHGITLPNAPGTIDSDYRGPLGVIVMNAGDAPFEIAHGDRIAQMV
VAPVLQARFQLVDSLSDSARGSGGFGSTGQR