Protein Info for HP15_260 in Marinobacter adhaerens HP15

Annotation: hydrolase, alpha/beta fold family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF07819: PGAP1" amino acids 12 to 121 (110 residues), 37.3 bits, see alignment E=8e-13 PF00561: Abhydrolase_1" amino acids 14 to 249 (236 residues), 96.4 bits, see alignment E=6.5e-31 PF00975: Thioesterase" amino acids 15 to 110 (96 residues), 38.7 bits, see alignment E=4e-13 PF12697: Abhydrolase_6" amino acids 16 to 255 (240 residues), 60.1 bits, see alignment E=1.5e-19 PF12146: Hydrolase_4" amino acids 16 to 249 (234 residues), 47.8 bits, see alignment E=3.8e-16 PF05057: DUF676" amino acids 17 to 116 (100 residues), 21.3 bits, see alignment E=5e-08

Best Hits

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 77% identity to maq:Maqu_0507)

Predicted SEED Role

"Esterase ybfF (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKY3 at UniProt or InterPro

Protein Sequence (265 amino acids)

>HP15_260 hydrolase, alpha/beta fold family protein (Marinobacter adhaerens HP15)
MTVALNHRITGEGPPLILLHGLFGSLDNLGGIARRLEDQWQIHALDERNHGSSPHTDTMD
YPAMAADVIAYMDAQALDKVSLLGHSMGGKVAMQVALQAPERVEKLIVADIAPVNYKPRH
DAILEGLTSMDLTGVRSRQDADRLMADFVEEPGVRQFLLKNLERIPREDQQEGGPMFRWR
LNLPVIDACYEHLARAPEGDGPFDGPVLFLKGADSAYIQEKHRDDIQRLFPQAQLRIIQG
TGHWLHAEKADSFAALCRRFLSADE