Protein Info for PGA1_c26560 in Phaeobacter inhibens DSM 17395

Annotation: Predicted dioxygenase of extradiol dioxygenase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 PF00903: Glyoxalase" amino acids 3 to 124 (122 residues), 36.9 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: K06991, (no description) (inferred from 80% identity to sit:TM1040_0467)

Predicted SEED Role

"ring-cleaving dioxygenase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E3K8 at UniProt or InterPro

Protein Sequence (136 amino acids)

>PGA1_c26560 Predicted dioxygenase of extradiol dioxygenase family (Phaeobacter inhibens DSM 17395)
MSIFHLAYHVDDLDRARGFYGGLLGCQEGRSTETWVDFNFFGHQISLHLGPVFATAKTGK
VGDHMVPMPHLGVILPQDEWRLLADRLEHAGLAFTIAPTTRFAGEPGEQSTMFFHDPAGN
PIEIKGFADMAGVFAT