Protein Info for PGA1_c26510 in Phaeobacter inhibens DSM 17395

Annotation: rod shape-determining protein MreC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details TIGR00219: rod shape-determining protein MreC" amino acids 69 to 268 (200 residues), 96.6 bits, see alignment E=7.6e-32 PF04085: MreC" amino acids 129 to 268 (140 residues), 106.6 bits, see alignment E=5e-35

Best Hits

Swiss-Prot: 68% identical to MREC_RHOSH: Cell shape-determining protein MreC (mreC) from Rhodobacter sphaeroides

KEGG orthology group: K03570, rod shape-determining protein MreC (inferred from 81% identity to sit:TM1040_0472)

Predicted SEED Role

"Rod shape-determining protein MreC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E3K4 at UniProt or InterPro

Protein Sequence (311 amino acids)

>PGA1_c26510 rod shape-determining protein MreC (Phaeobacter inhibens DSM 17395)
MAKDRSQRDDYTAPLRRLLTGVVCLCLLAIFLIWRIDSPRVERFRAQVVDAVVPSMDWAM
IPVEGAINLFRDFQSYQRLAEQNRELRSELRQMRAWKEAALQLEQENARLLDLNNVRLDP
RLTYVTGVVMADSGSPFRQSVILNVGARDGVRDGWAAMDGIGLVGRISGTGQDTARVILL
TDAASAVPALIQPSGQSTLVAGDNSPAPVIDFLENPDLVRPGDRVVTSGDGNVFPAGLLI
GQVTQDRFGRLRVRLSADYERLEFLRVLRHHGSEVIKDPGGLVVPAPGINIPQPRPEGLG
NEAAAGATDGE