Protein Info for Psest_0262 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 856 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 513 to 528 (16 residues), see Phobius details PF03924: CHASE" amino acids 89 to 276 (188 residues), 216.3 bits, see alignment E=8e-68 TIGR00229: PAS domain S-box protein" amino acids 369 to 493 (125 residues), 49.5 bits, see alignment E=2.3e-17 PF08447: PAS_3" amino acids 394 to 481 (88 residues), 48.7 bits, see alignment E=1.8e-16 PF00512: HisKA" amino acids 494 to 562 (69 residues), 63 bits, see alignment E=5.3e-21 PF02518: HATPase_c" amino acids 608 to 718 (111 residues), 104.3 bits, see alignment E=1.3e-33 PF00072: Response_reg" amino acids 733 to 841 (109 residues), 54.5 bits, see alignment E=3.1e-18

Best Hits

KEGG orthology group: None (inferred from 86% identity to psa:PST_3988)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GDP9 at UniProt or InterPro

Protein Sequence (856 amino acids)

>Psest_0262 PAS domain S-box (Pseudomonas stutzeri RCH2)
MSDPVNQQRPIQGLRQLFSRRNGIAWAMLLFTLLVQLVVWHNLRSSENRAAEQQFEMLSE
KVTEAIRKRLRDHEQILLGGAGLFDAVEQVSREQWHAYVERLLLPDRYPGIQGVGFTQAI
PAASRDAHVARIRAQGFPDYDIYPPGPRDFYTSIIFLEPFVGRNLAAFGYDMYSEPTRRR
AMRRAAQLGETSITGKVTLMQETHGKVQAGVLLYVPVYQPGASLLTPKQRMQALIGFVYS
PYRVEDLMRGILRAADLPLALHIYASDGEQAEQLIYASRETVSPDHSRYSQVQQLNLYGQ
TWTLRLDSLPEFDNRFHSNEALVMALGLGLSLLVFFLTSSLALRHSRAQAMAEEMTRHIR
QSRHDLRLSEERLSLALKGSNDGLWDLDLDAGSMYASPRAWEILGYRPNELTCDLKLWER
VTVAEDLAQQKARLAQTMLSNVDHFTTELRLQHKHGHVVPVLLRGYIQRDAQGMAQRISG
TLMDLTERKRVEQMKNDFVSTVSHELRTPLTSISGALGLIVGGALGSAPASMQQMLEIAY
RNSLRLGHLINDLLDMEKIAAGKMSFELREHSLGDLLEESLASNQALCEQHGIRCSLDHP
VDVLVWVDGMRLQQVLGNFLSNAVKFTPQGGEIRLHSSLRGPRVRISVTDQGPGIPEAFR
SRVFEKFAQADASDSRQKSGTGLGLAITKELIERMGGTVGFDCPPGQGTTFWCELPIQQL
ASETDSRDDLPRILVVEDEPDTGRLLHMMLREGGYGVERVQSLHQAREKLAAGRYEAMTL
DLHLPDGSGMQLIDELREKPAMQNLPIVVISAAHQFDQAQFPERIVWLHKPITNVQLLTA
VEKARDNVRQANSGKA