Protein Info for PGA1_c26450 in Phaeobacter inhibens DSM 17395

Annotation: glutamine-dependent NAD(+) synthetase NadE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00795: CN_hydrolase
  • amino acids 6 to 247 (242 residues), 102.9 bits, E=2.8e-33
• PF02540: NAD_synthase
  • amino acids 271 to 523 (253 residues), 224.5 bits, E=1.8e-70
• TIGR00552: NAD+ synthetase
  • amino acids 274 to 523 (250 residues), 182.2 bits, E=5.2e-58

Best Hits

Swiss-Prot: 64% identical to NADE_RHOCA: Glutamine-dependent NAD(+) synthetase (nadE) from Rhodobacter capsulatus

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 87% identity to sit:TM1040_2278)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5) / Glutamine amidotransferase chain of NAD synthetase" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• NAD de novo biosynthesis II (from tryptophan) (6/9 steps found)
• NAD salvage (plants) (6/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (8/14 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

See I7EPY6 at UniProt or InterPro

Protein Sequence (552 amino acids)

>PGA1_c26450 glutamine-dependent NAD(+) synthetase NadE (Phaeobacter inhibens DSM 17395)
MADRFRVTLAQLNPTVGDLAGNANKAREAWAAGRDAGADLVALPEMFITGYNTQDLVQKP
VFHQAAIAEVERLAADCADGPALAVGSPWVADGKLFNAYLILKGGKITTQVLKHHLPNAT
VFDEVRIFDAGPLGGPYAVGNTRIGSPICEDGWYEDVAETLAETGAEFLLIPNGSPYFRN
KMDVRFNHMVARAVETDLPVIYLNMVGGQDDQVFDGGSFVLNPGGALALQMPVFDEAIQH
LDLERTAEGWRAVEGPKASLPDEWEQDYHVMTLSLRDYMRKTGFKKVLLGLSGGVDSAIV
ATIAVDALGAENVRCVMLPSEYTSQESLDDAEAVAKALGVHYDYVPIAEGRAAITNTLAP
LFAGLDEGLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYGDMAGGYNP
IKDLYKTRVFETCRWRNDNHRDWMMGPEGEVIRPNVIDKPPSAELRDDQKDSDSLPDYPE
LDALLEILVDRDGSIADCVAAGFSRENAKRVEHLIYISEYKRFQSAPGARLTPRAFWLDR
RYPIVNRWRDPS