Protein Info for HP15_2548 in Marinobacter adhaerens HP15

Annotation: xanthine/uracil permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 375 to 401 (27 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 17 to 391 (375 residues), 181.1 bits, see alignment E=1.5e-57

Best Hits

Swiss-Prot: 52% identical to ADEP_ECOLI: Adenine permease AdeP (adeP) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 91% identity to maq:Maqu_2813)

MetaCyc: 52% identical to adenine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-447

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIR1 at UniProt or InterPro

Protein Sequence (432 amino acids)

>HP15_2548 xanthine/uracil permease family protein (Marinobacter adhaerens HP15)
MLERLFQLQAHGTTVRKEVVAGITTFLTMAYIIVVNPSILSSTGMDFGAVFVATCLAAVI
GTLIMGLWANYPIAMAPGMGLNAFFSFTVVGSMGYSWQIALGAVFISGFLFFMLSIFKVR
EWIINSIPMSLRFGISAGIGFFLALIALKNAGIVVDHPATLVGLGEVKVAESLLFFGGFV
LICALSFRQVTGAVMIGIIAVTGVAMALGMVEYNGLVSAPPSIAPTFMQLDLAGALNIGM
ISVIFAFLFVDLFDTSGTLIGAAQRGGLLDKDGKLPRLGRALMSDSVATMSGAALGTSTT
TSYIESTAGISAGGRTGLTAVVVAALFLACLLLSPIASIIPAYATAPALLYVAILMASGL
KLIDWEDVTDAAPAVVTALMMPLTFSIANGIALGFITYAILKALSGRWADLNASVVIIAV
VFVLKFIFLDAA