Protein Info for HP15_2547 in Marinobacter adhaerens HP15

Annotation: membrane protein containing uncharacterized protein family UPF0126 domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details PF03458: Gly_transporter" amino acids 7 to 79 (73 residues), 81.1 bits, see alignment E=2.2e-27 amino acids 94 to 167 (74 residues), 86 bits, see alignment E=6.5e-29

Best Hits

KEGG orthology group: None (inferred from 86% identity to maq:Maqu_2812)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIR0 at UniProt or InterPro

Protein Sequence (205 amino acids)

>HP15_2547 membrane protein containing uncharacterized protein family UPF0126 domains (Marinobacter adhaerens HP15)
MIDIIYVLEMVGIVAFAISGMIVARSKNMDPVGVFTIGFITALGGGTLRDLIMDNHPLYW
IKHEEQPMLILAMAVVFSYWKKAERLRESRIVFPDAIGLGVFSILGAQLALDLGHSWFVA
SLLGVMTGTFGGALRDTLCNEVPYIFRKDQIYASISFAGCWLYFVCQWFLDNEVLPLTIG
LLFIVIVRMLAVRFDIRLQRDSHSN