Protein Info for HP15_2545 in Marinobacter adhaerens HP15

Annotation: oxidoreductase, zinc-binding dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF08240: ADH_N" amino acids 29 to 86 (58 residues), 44.1 bits, see alignment E=2.4e-15 PF00107: ADH_zinc_N" amino acids 151 to 274 (124 residues), 104.3 bits, see alignment E=7.4e-34 PF13602: ADH_zinc_N_2" amino acids 184 to 322 (139 residues), 70.3 bits, see alignment E=5.2e-23

Best Hits

Swiss-Prot: 45% identical to QORL2_NEMVE: Quinone oxidoreductase-like protein 2 homolog (v1g238856) from Nematostella vectensis

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 83% identity to maq:Maqu_2810)

Predicted SEED Role

"Putative Zn-dependent oxidoreductase PA5234"

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIQ8 at UniProt or InterPro

Protein Sequence (326 amino acids)

>HP15_2545 oxidoreductase, zinc-binding dehydrogenase family protein (Marinobacter adhaerens HP15)
MKAILCKEYGPAEKLVIEEVPSPEVKGRGVKVRVKAAGLNFPDTLIIENKYQLKPSLPFS
PGGEMAGEVIEVGDKVTRFKVGDRVAGLTGYGAFAEEVIVPEQNLLPVPDGMSDEKAAAF
TMVYGTSYYALKQRGNLQPGESLLVLGASGGVGLATVELGKAMGAKVIAAASSAEKLAVA
KEAGADELINYAEEPLKDAVKKLTHSKGVDVIYDPVGGDFTEQALRAMGWNGRHLIIGFA
AGEIPKIPANLTLLKGCSVVGVFWGSFTQREPEASAQNMMELMKLYAEGKIDPKISAVYD
FEDYAQALGALTERKATGKVVLKVGS