Protein Info for Psest_0261 in Pseudomonas stutzeri RCH2

Annotation: alternative sigma factor RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR02392: alternative sigma factor RpoH" amino acids 16 to 283 (268 residues), 413.7 bits, see alignment E=3.9e-128 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 49 to 279 (231 residues), 107.2 bits, see alignment E=6.9e-35 PF04542: Sigma70_r2" amino acids 54 to 123 (70 residues), 65 bits, see alignment E=4.3e-22 PF04545: Sigma70_r4" amino acids 229 to 279 (51 residues), 55.9 bits, see alignment 2.5e-19

Best Hits

Swiss-Prot: 90% identical to RPOH_PSEAE: RNA polymerase sigma factor RpoH (rpoH) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 99% identity to psa:PST_3989)

MetaCyc: 61% identical to RNA polymerase sigma factor RpoH (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGI5 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Psest_0261 alternative sigma factor RpoH (Pseudomonas stutzeri RCH2)
MTTTLQPVQALVPGANLEAYVQTVNSLPLLTVEQERELAGRLFYHQDLEAARQMVLAHLR
FVVHIARSYSGYGLAQADLIQEGNVGLMKAVKRFNPEMGVRLVSFAVHWIRAEIHEFILR
NWRIVKVATTKAQRKLFFNLRSQKKRLAWLNNDEVTAVADSLGVEPHEVREMESRLTGHD
MAFDPAADADDDSAYQSPAHYLEDHRYDPARQLEDADWSDSSTSSLHTALEGLDERSRDI
LQQRWLNEDKATLHDLAAKYNVSAERIRQLEKNAMNKLKGSIQA