Protein Info for PGA1_c26390 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 841 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 260 to 286 (27 residues), see Phobius details amino acids 307 to 334 (28 residues), see Phobius details amino acids 348 to 374 (27 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 429 to 452 (24 residues), see Phobius details amino acids 479 to 498 (20 residues), see Phobius details amino acids 717 to 739 (23 residues), see Phobius details amino acids 760 to 789 (30 residues), see Phobius details amino acids 802 to 826 (25 residues), see Phobius details PF02687: FtsX" amino acids 266 to 379 (114 residues), 34 bits, see alignment E=1.4e-12 amino acids 722 to 829 (108 residues), 42.9 bits, see alignment E=2.4e-15

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 72% identity to sit:TM1040_2271)

Predicted SEED Role

"ABC transporter, permease protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZG5 at UniProt or InterPro

Protein Sequence (841 amino acids)

>PGA1_c26390 ABC transporter, permease protein (Phaeobacter inhibens DSM 17395)
MSPSALSLATRFAKRELRGGLSGFRVFLICLALGVAVIAGIGSLRSAIQTGLSEEGAVLL
GGDAELGFTYRRATAEEQAWMEARALARSEIIDFRSMATVGDERALTQVKAVDDAYPLVG
TVILSPGLPLEAALAGTGDFPGGVMQRVLADRLGLSVGDEFTLGSQQFVLTALLENEPDA
ASAGFTLGPRTLVRTEDLAQSGLLQPGTLFSSKYRLTLPPDTDLEQLKTRAEAEYDNSGM
RWTDARNGAPGIATFVERLAGFLVLVGLSGLAVGGIGVSAAVRAYLAGKTATIATLRTLG
ADRRTIFLTYFLQIGALALLGVAIGLVIGGLAPVLLGPLIAAQLPFPAVFGISVSALSEA
ALYGLLTAFVFALWPLARAERIRAAALFRDALDSRSRWPASRYILATVVAVAVLIGAAAL
FSGAVELTLWTAGGLIGALAVLLLAALVLGWIARRSAPLARGNPALRWALSAIGTSRDGA
VPTVLALGLGLTVLAAIGQVDGNMRRAIEGNLPDVAPSYFFVDIQRDQMPDFLARVEQDP
AVDRVQSAPMLRGVLTTINGQPATEVAGDHWVVRGDRGITYAAKQPETTQIVAGTWWAED
YSGPPQVSFAREEAEELGLDLGDTLTINVLGRDITATITSLREVDFSTAGMGFVMVLNEN
ALAGAPHSYIATVYAEQEAEAQILRDLARAMPNITAVRVRDALDRVSEILRQLASATAYG
AAATLLTGFMVLIGTAAAGEPARRYEAAVLKTLGASRRRILISFALRSVFLGAGAGLVAL
IAGMSGAWAINTYVFESDYQVIWGNALAIISGGILTTLLAGLAFAWRPLQVRPARILRAR
D