Protein Info for HP15_2542 in Marinobacter adhaerens HP15

Annotation: methylcrotonoyl-coenzyme A carboxylase 1 (alpha)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 PF00289: Biotin_carb_N" amino acids 1 to 110 (110 residues), 157.1 bits, see alignment E=7.2e-50 PF02786: CPSase_L_D2" amino acids 116 to 322 (207 residues), 260.6 bits, see alignment E=3.4e-81 PF07478: Dala_Dala_lig_C" amino acids 125 to 291 (167 residues), 41.2 bits, see alignment E=4.8e-14 PF02222: ATP-grasp" amino acids 125 to 292 (168 residues), 29.7 bits, see alignment E=1.6e-10 PF02785: Biotin_carb_C" amino acids 336 to 442 (107 residues), 121 bits, see alignment E=8.4e-39 PF00364: Biotin_lipoyl" amino acids 584 to 644 (61 residues), 60.2 bits, see alignment 4.8e-20

Best Hits

KEGG orthology group: K13777, geranyl-CoA carboxylase alpha subunit [EC: 6.4.1.5] (inferred from 84% identity to maq:Maqu_2807)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.5

Use Curated BLAST to search for 6.4.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIQ5 at UniProt or InterPro

Protein Sequence (656 amino acids)

>HP15_2542 methylcrotonoyl-coenzyme A carboxylase 1 (alpha) (Marinobacter adhaerens HP15)
MLRKLLIANRGEIAVRVIRTAKALGYRTVAVYSEADAKAMHVELADEAVCIGPAQVSASY
LNSDAILEAARKTGADCIHPGYGFLSENAAFANACKDAGLVFVGPPASAIELMGSKRRSK
IAMQEAGVPVVPGYEGNNANDDELIAAAKDIGYPLMIKASAGGGGRGMRLVESESELADN
IKRARSESKQAFGDDELILEKAVIEPRHVEIQVFADRHGNAVYLGERDCSVQRRHQKVVE
EAPSPFVTPELRQAMGEAAVKAALACNYEGAGTVEFLVDKHRNFYFLEMNTRLQVEHPVT
ELITGQDLVAWQLNVAEGRPLPLSQDDIHLNGHAIEVRLYAEDPAHGFTPQTGSLYAFEP
AEGEGLRFDTGVRSGDAITPHYDPMLAKVIAWGQNRDEARRRLIRSLEDTTVFGVTTNRH
FLSRIIADETFGAGGATTAFLQQAFKDDPSLQPQNLTIRQLALAACVLDHGISGQSAWSN
APATMTPIKLETGDTTVELLVTRSGSRLSVSMGETRHSLVLESQRDGHLCIIDNGVRQAC
QYHRQGDSLYLQAFGQSWSVRDVTHQPARTAGGAGSGRIQATMDGAIIDVLVEAGQSVHQ
GDTLVILEAMKMEHPVKADRDGRVAEILASKGDQVKRSQLLVQITANETAEQENEA