Protein Info for HP15_2541 in Marinobacter adhaerens HP15

Annotation: enoyl-CoA hydratase/isomerase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00378: ECH_1" amino acids 19 to 270 (252 residues), 161.6 bits, see alignment E=2.2e-51 PF16113: ECH_2" amino acids 20 to 233 (214 residues), 130.2 bits, see alignment E=1.3e-41

Best Hits

KEGG orthology group: K13779, isohexenylglutaconyl-CoA hydratase [EC: 4.2.1.57] (inferred from 83% identity to maq:Maqu_2806)

MetaCyc: 59% identical to isohexenyl-glutaconyl-CoA hydratase (Pseudomonas aeruginosa PAO1)
Isohexenylglutaconyl-CoA hydratase. [EC: 4.2.1.57]

Predicted SEED Role

"Isohexenylglutaconyl-CoA hydratase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIQ4 at UniProt or InterPro

Protein Sequence (273 amino acids)

>HP15_2541 enoyl-CoA hydratase/isomerase family protein (Marinobacter adhaerens HP15)
MDQVPHCETLLLEKQGPTLFITINRPDVRNAMSLEMVAELSAVFTQIENDLHIRAVVIRG
AGGHFCAGGDIKDMAGARGQKAAEGEADPFYRLNRAFGQMIQQVNESSKVVIAITEGAVM
GGGFGLACVSDVAIAGPSAKFGMPETSLGVIPAQIAPFVVERIGLTQARRLALLGLRIDA
NEACSLGIVHQAASSDDELEEMLTSALDRVRHCAPVATAETKALLHRVGHEPISGLLDSA
AEKFAEAIRGSEGTEGTMAFMQKRPPAWAESND