Protein Info for PGA1_c26280 in Phaeobacter inhibens DSM 17395

Annotation: Predicted permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details PF00892: EamA" amino acids 13 to 140 (128 residues), 39.2 bits, see alignment E=4.1e-14 amino acids 150 to 275 (126 residues), 30.4 bits, see alignment E=2.2e-11

Best Hits

KEGG orthology group: None (inferred from 66% identity to sil:SPO0450)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DTA8 at UniProt or InterPro

Protein Sequence (282 amino acids)

>PGA1_c26280 Predicted permease, DMT superfamily (Phaeobacter inhibens DSM 17395)
MPVTAGAMVRAVMIMFVAMSMIPAGDLCGKLLTSGGLATPGFVAWSRFAIGTVLVLPFAW
RGAWPLFGDWRLWLRAALLSGGILSIQIALKTEPLADVFAAFFIGPIVSYVLSVLLLREA
VTPTRSLLMALGFCGVLLVVRPGLGGSANLIWAAVAGVCYGGFLTSSRWLSHLGTPLQLS
LTQLSISALLTLPLGLTALPAPSLSTAALTFGSAGFSMLGNLLLLFAYAQAPASRLAPLV
YFQLIAAVSLGWWAFAQWPDPLTWAGLAVVIGAGLLSAGLRR