Protein Info for PGA1_c26270 in Phaeobacter inhibens DSM 17395

Annotation: putative D-alanyl-D-alanine carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 428 to 451 (24 residues), see Phobius details PF02113: Peptidase_S13" amino acids 55 to 456 (402 residues), 200.1 bits, see alignment E=6e-63 TIGR00666: D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase" amino acids 82 to 450 (369 residues), 175.2 bits, see alignment E=9.4e-56 PF13354: Beta-lactamase2" amino acids 348 to 456 (109 residues), 22.7 bits, see alignment E=5e-09

Best Hits

KEGG orthology group: K07259, D-alanyl-D-alanine carboxypeptidase / D-alanyl-D-alanine-endopeptidase (penicillin-binding protein 4) [EC: 3.4.16.4 3.4.21.-] (inferred from 60% identity to sit:TM1040_2259)

Predicted SEED Role

"D-alanyl-D-alanine carboxypeptidase (EC 3.4.16.4)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.16.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4, 3.4.21.-

Use Curated BLAST to search for 3.4.16.4 or 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F1W7 at UniProt or InterPro

Protein Sequence (494 amino acids)

>PGA1_c26270 putative D-alanyl-D-alanine carboxypeptidase (Phaeobacter inhibens DSM 17395)
MISRRFFLTTCLASAAANTALANAPAVSLRPVARDPASLIRAGGGLKGLLSRAGLSGEVA
CAVADVKTGLRLEAEGAGAGLPPASVAKALTALYALDALGADHRFTTQIVATGGISGGVV
AGDLVLVGGGDPMLNTDTLAQLAQALKTAGIREVRGAFRVWEGALPQIRTIDPGQPDHVG
YSPAISGLALNYNRVHFEWKRAGQGWAVTMDARTKKYRPEVSVATMKIAQRSLPVYSYSE
GKDTDRWTVASKALGKGGARWLPVRHPGAYTADVFRTMARANGVKLGNPKMAKSRPSGQV
VAHHNSPPLDLMLKATLKYSNNLMAEMIGLAATQARGGRPRSLRDSAAEMNRWAAATYGM
ANTRLVDHSGLGEDSRVTPDDMVSVLVAAYRDGRLKPLLKSFPMRDSKGRILKGHPIKVA
AKTGTLNFVSGLGGFMTATDGTVLAFAIFSADQKARSRISRAERERPQGARSWNRRAKQV
QQKLIERWGRVYGS