Protein Info for Psest_2628 in Pseudomonas stutzeri RCH2

Annotation: Flp pilus assembly protein, protease CpaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details PF01478: Peptidase_A24" amino acids 6 to 108 (103 residues), 65.9 bits, see alignment E=2.1e-22

Best Hits

KEGG orthology group: K02278, prepilin peptidase CpaA [EC: 3.4.23.43] (inferred from 54% identity to pba:PSEBR_a4094)

Predicted SEED Role

"Type IV prepilin peptidase TadV/CpaA" in subsystem Widespread colonization island

Isozymes

Compare fitness of predicted isozymes for: 3.4.23.43

Use Curated BLAST to search for 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP98 at UniProt or InterPro

Protein Sequence (168 amino acids)

>Psest_2628 Flp pilus assembly protein, protease CpaA (Pseudomonas stutzeri RCH2)
MAIEWIVLLSLAGYAALIDLRQHRIPNSLVVFGIAAGVVGQVFGAGWSGLGTSAISAAIG
FAIFIPLYALGGMAAGDVKLMAMVGTFMAPQQALLASLLALMAGGIGGLLLIAVHGQLRQ
TLTRYTVMLGAHRYLAPDKNEVAGKRFPYAIAILLGTLGSMLWFEFAR