Protein Info for Psest_0258 in Pseudomonas stutzeri RCH2

Annotation: signal recognition particle-docking protein FtsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 PF02881: SRP54_N" amino acids 136 to 201 (66 residues), 54.8 bits, see alignment E=1.8e-18 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 149 to 420 (272 residues), 367.5 bits, see alignment E=2.1e-114 PF06414: Zeta_toxin" amino acids 215 to 326 (112 residues), 31.2 bits, see alignment E=3.1e-11 PF00448: SRP54" amino acids 220 to 420 (201 residues), 260.7 bits, see alignment E=1.6e-81

Best Hits

Swiss-Prot: 59% identical to FTSY_ECOLI: Signal recognition particle receptor FtsY (ftsY) from Escherichia coli (strain K12)

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 87% identity to psa:PST_3992)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHT1 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Psest_0258 signal recognition particle-docking protein FtsY (Pseudomonas stutzeri RCH2)
MFGSNDDKKTPAEPGEKKGLFGWLRKKPQQPVAEQPAAEPQEDSLPHAEQPETEIEQPVI
DAPAVLSERAVEAEILPEPEPEPEPEPEPEPEPEPEPELVIAPVPVVAAAPAQAPAKLGF
FARLKQGLSKTSSSIGEGMASLFLGKKAIDDDLLDELETRLLTADVGVEATTAIMQNLTR
RVSRKELADSGALYTALQEELAGLLKPVEQPLVVDSGKRPYVILVVGVNGVGKTTTIGKL
AKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNSIPVIAQHTGADSASVIFDAVQAAKA
RGIDVLIADTAGRLHTKDNLMEELKKVRRVMGKLDDSAPHEVLLVLDAGTGQNAINQTRQ
FNQSVELTGLVLTKLDGTAKGGVIFALAKQFGTPIRYIGVGEGIDDLRTFEADAFVKALF
AQREDA