Protein Info for Psest_2618 in Pseudomonas stutzeri RCH2

Annotation: Flp pilus assembly protein TadB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 124 to 140 (17 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details PF19360: TadB_TadC_N" amino acids 11 to 121 (111 residues), 29.6 bits, see alignment E=5.4e-11 PF00482: T2SSF" amino acids 161 to 286 (126 residues), 72.7 bits, see alignment E=2.9e-24

Best Hits

KEGG orthology group: K12510, tight adherence protein B (inferred from 71% identity to pba:PSEBR_a4086)

Predicted SEED Role

"Flp pilus assembly protein TadB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP88 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Psest_2618 Flp pilus assembly protein TadB (Pseudomonas stutzeri RCH2)
MRQIPTEYILVFLGMIFVAVVLLSQGLTIPVFGEAGKMRKRIRARLHLLEHSNNGPSMQM
LLREKYLTRLSPLQARLEQLPMMERLAQMIEQSGHHYLAHRVVLAGVALAALASAAIWVV
TLQWWLSAGAGLAAFWLPIGKISRDRAARFTAFEEGLPDALDSVCRALRAGHPFGESLRL
VADEHKGPVAQEFGLVFADINYGNDVRRAMLGLLERVPSMTVMMLVTSVLIHRETGGNLT
EVLERMSALVRGRFRFQRKVRTLSAEGRMSAWVLVAVPFVLAAVIMLTTPDYLPMLLNEP
AGQKLAVAAFVGMLAGILWIRRIIRIQV