Protein Info for HP15_2510 in Marinobacter adhaerens HP15

Annotation: flagellar motor protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 281 (281 residues), 400.9 bits, see alignment E=1.3e-124 PF20560: MotA_N" amino acids 4 to 93 (90 residues), 113.5 bits, see alignment E=4.4e-37 PF01618: MotA_ExbB" amino acids 138 to 223 (86 residues), 42.2 bits, see alignment E=6.7e-15

Best Hits

Swiss-Prot: 42% identical to LAFT_VIBPA: Chemotaxis protein LafT (lafT) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 88% identity to maq:Maqu_2779)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PHY6 at UniProt or InterPro

Protein Sequence (283 amino acids)

>HP15_2510 flagellar motor protein MotA (Marinobacter adhaerens HP15)
MLLIVGSIIVLASVLTGYVLHGGNLMVLWQPTEVLIIFGAALGSFIIANPVHTLKEVFGK
GVQLLTGSPYKKAFYMDLLSLLYEIFDKSRKQGVMAIEEDIDNPEASQIFSRYPAVMKSK
ELLAFITDYLRIISSGNMATHELEGMMENEIDSRQHELEEPAHAVNKIADALPGLGIVAA
VLGIVITMNFLTEGPEKIGLSVAAALVGTFLGIFMGYGFVGPASIAMEHAAKYELKAYEC
VKSAIVATVSGQAPQMAIEFGRKALPTDKRPGFQELNDHVRSK