Protein Info for Psest_2607 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 22 to 23 (2 residues), see Phobius details transmembrane" amino acids 24 to 42 (19 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 210 to 226 (17 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 372 to 390 (19 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_1755)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK57 at UniProt or InterPro

Protein Sequence (432 amino acids)

>Psest_2607 hypothetical protein (Pseudomonas stutzeri RCH2)
MNQSLLITPRQRDSNPLAFDKPTLLTLVVASLLLTETFSGALRYYFDMAGISWLLYLPKV
ACLLALSLELLRYRGWPAFWLVLLGLVTSSQLALLHGAELGNIGFSLFIYIPLLFGLICG
RHLELRLGLLRRIIGFCLIASFVGIALDLLTSVPWKGYSYMVGEVELSANRSWAFDDIDR
IGGFARMSTALSVMIAVYSLFIAAFTRSRLLRLMLYAAALVGIVLTTNKSTAAAYVLTLL
MLVVTAYRFASATAFLIAVLVGLALPMASLVLSLDPNAANNGTLLASFADRLINSWPNFI
GVITREGWGWWGAGFGAVGSAGQVYPMPGLELLSIADNTALYLWGMLGVFGVLLYLLTFP
LMLRLHERGPRLRSALLPIVFCICLVAWATDVLEVSIATLFLGLAISHVLTPARRPISSL
TGQRLPELQHLT