Protein Info for Psest_2605 in Pseudomonas stutzeri RCH2

Annotation: transcriptional activator RfaH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF02357: NusG" amino acids 8 to 102 (95 residues), 79.4 bits, see alignment E=1.2e-26 TIGR01955: transcription elongation factor/antiterminator RfaH" amino acids 9 to 163 (155 residues), 185 bits, see alignment E=4.7e-59

Best Hits

KEGG orthology group: K05785, transcriptional antiterminator RfaH (inferred from 83% identity to psa:PST_1757)

Predicted SEED Role

"Transcriptional activator RfaH" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM98 at UniProt or InterPro

Protein Sequence (169 amino acids)

>Psest_2605 transcriptional activator RfaH (Pseudomonas stutzeri RCH2)
MTPSNTARWYLIQTKPRQEARAEEHLLRQHFECYRPVKASSPSRGSPIARTGEALFPGYL
FIRLDCIHDNWYPIRSTRGVSRVVSFGGQPTPVRDELIAQLRQRLAQSESGRTATFNPGD
RVHVSGGSFSEIEAIFVSSDGEERSVILLNLLQREQKVRVPTRYLQCHC