Protein Info for Psest_2601 in Pseudomonas stutzeri RCH2

Annotation: Membrane protein involved in the export of O-antigen and teichoic acid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 163 to 187 (25 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details amino acids 446 to 466 (21 residues), see Phobius details amino acids 474 to 496 (23 residues), see Phobius details PF13440: Polysacc_synt_3" amino acids 42 to 342 (301 residues), 23.6 bits, see alignment E=1.5e-09

Best Hits

KEGG orthology group: None (inferred from 89% identity to psa:PST_1761)

Predicted SEED Role

"Polysaccharide biosynthesis domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMU8 at UniProt or InterPro

Protein Sequence (520 amino acids)

>Psest_2601 Membrane protein involved in the export of O-antigen and teichoic acid (Pseudomonas stutzeri RCH2)
MSDPKRFSVIRNTSLNYLGQAYALLVGILILPFYLGHLGAEAYGLIGFFAVLQAWLQLLD
AGMSPALVRQVAHYRGQGDLAAGRGPAGRLLRSFELLLLPIALVTCVTIYLGSGWIAQTW
LQARELSTGTIMQCISLMGLMVGLRLYATLYKSGLQGVELHGWLNAANMLIATLRYFGGL
FLVAYISQNPLDFFLFQAAVALVETLAFASKAYVQLSSPRLFTGIDWRVVRPVLPFAGGM
CFTSLLWIVLTQLDKVLLSKVLLLKEYGYFSLVALVTTGIMTLTNPLVQTLLPRMTMLVA
EQRIADMERLYLNASRFVCSVLFPMAAVIAWHGQALIYAWTGDSAAAEWSERMLFWYVPG
SALMAVSAFQFYLQYAYGQLRLHIWYSVISTAVSVPIVIYAALVHGAHGAALAWFFLRLA
TFIIWPPVVHRRFAPGMQGIWARDMLRITAMTALGIALGEPLFRLIASDNRFDILLALAV
SGAICLLPVAASSKPLVLKLYFLINKRASKNGIEERASLD