Protein Info for Psest_2600 in Pseudomonas stutzeri RCH2

Annotation: Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF01041: DegT_DnrJ_EryC1" amino acids 12 to 353 (342 residues), 305.7 bits, see alignment E=7.6e-95 PF01212: Beta_elim_lyase" amino acids 33 to 258 (226 residues), 35.7 bits, see alignment E=9.1e-13

Best Hits

KEGG orthology group: None (inferred from 86% identity to psa:PST_1762)

Predicted SEED Role

"Aminotransferase, DegT/DnrJ/EryC1/StrS family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM94 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Psest_2600 Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis (Pseudomonas stutzeri RCH2)
MINVTKSYLGNKNKFKAYVDRIYNTGWLTNHGPLVTALEQRLKDYLGVRNIILTNNGTIA
LQIAYRALGVTGSAITTPFSFVATTSSLQWEGIKPIFADIDPATWNLDPNQIARHIEPDT
TAIVATHVFGNPCDVERIEQVARRHNLKVIYDGAHAFGTRYKARSVYSWGDISTLSFHAT
KLFHTIEGGAIVTDDDDLAERIRLLCNFGIVDTDQIEGIGINAKLNEFSAAMGMCVLDDI
ELILECRAEIGQRYARRLGDHFELQKPQPESQGNFSYFPVALADEQQLLRCRTQLNESGI
NPRRYFYPSLDTLEHLQPQVPQPHSRALSRKVLCLPIYPGLPRKVQEKVMQTLIQESIHS
TQSDRILFRPFVEAFGLLSGEQLPAAECKRIS