Protein Info for PGA1_c25900 in Phaeobacter inhibens DSM 17395

Annotation: putative iron ABC transport system, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details transmembrane" amino acids 72 to 92 (21 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 249 to 274 (26 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details PF01032: FecCD" amino acids 29 to 337 (309 residues), 274.2 bits, see alignment E=6.5e-86

Best Hits

Swiss-Prot: 38% identical to YFIZ_BACSU: Probable siderophore transport system permease protein YfiZ (yfiZ) from Bacillus subtilis (strain 168)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 48% identity to apn:Asphe3_37780)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EPT5 at UniProt or InterPro

Protein Sequence (343 amino acids)

>PGA1_c25900 putative iron ABC transport system, permease protein (Phaeobacter inhibens DSM 17395)
MAVSTLTLPGRTPTGDLRLLWLAAALLTLCLLSAAALSLGARATSWAEIWGGLTAYDPNN
ADHIVVRNMRLPRLIGAGLAGAALGMSGALIQAMTRNPLADPGLLGINGGAALGVVLCIL
VLGVTDPAEFIWVALGGGLAASVLVFLLGGGSQANPLRLILAGAAVSALFLALTRALLLV
SRQTLDVYRFWVLGGFDGILPATLQSLLPFLILGALLAIIAGFGLNALMLGEDTAKGLGV
RTGLTRLTAGAAIVLLCGATVAMAGPIAFAGLIVPHMARWAAGPAIGWSLAFSAVFGALL
LIAADLLGRLALFGGNMQAGVMTALIGGPVLIWLVRRNGVRKL