Protein Info for Psest_2594 in Pseudomonas stutzeri RCH2

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00106: adh_short" amino acids 4 to 197 (194 residues), 171.7 bits, see alignment E=2.8e-54 PF23441: SDR" amino acids 4 to 243 (240 residues), 37.5 bits, see alignment E=3.6e-13 PF08659: KR" amino acids 5 to 168 (164 residues), 59.5 bits, see alignment E=8.7e-20 PF13561: adh_short_C2" amino acids 9 to 247 (239 residues), 200.8 bits, see alignment E=5e-63

Best Hits

Swiss-Prot: 56% identical to YGFF_ECOLI: Uncharacterized oxidoreductase YgfF (ygfF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to psa:PST_1769)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMU3 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Psest_2594 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Pseudomonas stutzeri RCH2)
MSRVMLITGASRGIGAATARLAARQGYALCLNFHQREDAANQVLEQVRAAGVPAITVKAD
VADESQVLQMFEVIDREFGRLDVLVNNAGMLEQQMRLEQMDAARWMRVLGANVIGSFLCA
REAIKRMSTKHGGQGGSIINLSSIAARLGAPGEYIDYAAAKGAIDSMTVGLAREVAGEGI
RVNAVRPGVIHTEIHASGGEPDRIERVKASVPMGRGGQAEEIAEAILWLASEQASYTTGA
LLDVSGGR