Protein Info for Psest_2588 in Pseudomonas stutzeri RCH2

Annotation: aspartate-semialdehyde dehydrogenase, gamma-proteobacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 TIGR01745: aspartate-semialdehyde dehydrogenase" amino acids 2 to 368 (367 residues), 648.9 bits, see alignment E=1e-199 PF01118: Semialdhyde_dh" amino acids 3 to 121 (119 residues), 90.6 bits, see alignment E=1e-29 PF02774: Semialdhyde_dhC" amino acids 144 to 354 (211 residues), 188.4 bits, see alignment E=1.4e-59

Best Hits

Swiss-Prot: 91% identical to DHAS_PSEAE: Aspartate-semialdehyde dehydrogenase (asd) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 100% identity to psa:PST_1775)

MetaCyc: 70% identical to aspartate-beta-semialdehyde dehydrogenase subunit (Vibrio cholerae)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.11

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM85 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Psest_2588 aspartate-semialdehyde dehydrogenase, gamma-proteobacterial (Pseudomonas stutzeri RCH2)
MKRVGLIGWRGMVGSVLMQRMLEERDFDLIEPVFFTTSNVGGQGPDIGKETAALKDAYSI
DELKGLDVILTCQGGDYTNEVFPKLREAGWQGYWIDAASSLRMQDDAVIVLDPVNRRVID
QQLDAGTKNYIGGNCTVSLALMGLGGLFEAGLVEWMSAMTYQAASGAGAQNMRELIKQMG
AINAAVADDLANPASAILDIDRKVAETQRSEAFPVDNFGVPLAGSLIPYIDKELPNGQSR
EEWKAQAETNKILGRFKNPIPVDGICVRVGAMRCHSQALTIKLNKDVPISDIEGLISQHN
PWVKLVPNHRDASMQELSPAAVTGTLSVPVGRLRKLNMGSHYLGAFTVGDQLLWGAAEPL
RRMLRILLER