Protein Info for Psest_2584 in Pseudomonas stutzeri RCH2

Annotation: Phosphoribosylanthranilate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00697: PRAI
  • amino acids 7 to 201 (195 residues), 168.4 bits, E=7.9e-54

Best Hits

Swiss-Prot: 86% identical to TRPF_PSEU5: N-(5'-phosphoribosyl)anthranilate isomerase (trpF) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01817, phosphoribosylanthranilate isomerase [EC: 5.3.1.24] (inferred from 86% identity to psa:PST_1779)

Predicted SEED Role

"Phosphoribosylanthranilate isomerase (EC 5.3.1.24)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 5.3.1.24)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• L-tryptophan biosynthesis (6/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.24

Sequence Analysis Tools

See L0GMT5 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Psest_2584 Phosphoribosylanthranilate isomerase (Pseudomonas stutzeri RCH2)
MPVVRSKICGITRVEDALAAAHAGADAIGLVFYSKSPRAVSVQQAREIIAALPPFVTTVG
LFVNASRCEINEILDAVALDALQFHGDETPAQCEGFHRPWFKALRVGGDEDVAGQVARYV
NASGILLDTFVAGVPGGTGERFDWSLIPPGLTKPLILAGGLTAENVQQAIAEVRPYAVDV
SGGVEASKGIKDAAKVQAFVERVRSAM