Protein Info for Psest_2581 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF05036: SPOR" amino acids 135 to 204 (70 residues), 63.3 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: K03749, DedD protein (inferred from 82% identity to psa:PST_1782)

Predicted SEED Role

"DedD protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP51 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Psest_2581 Uncharacterized protein conserved in bacteria (Pseudomonas stutzeri RCH2)
MAMLDKGLLQRMVGALVLIALAVIFVPMLFNREDDLRHVTVDAPTIPAAPVVAEIEMQPV
DVPEPEQEPGSVPEGFEIIEEDAEPATGPAIAEQAPAPIEPVVPVAPAAAPAAPAAQAQS
PAAEPRLDNNNLPVSWAIQLASLSNRASAENLQQTLRSQGYNAYIRTADGMNRVFVGPLV
ERSEANRLRDVLQRQQKLDGFVVRFKPEGS