Protein Info for PGA1_c25590 in Phaeobacter inhibens DSM 17395

Annotation: putative glycine betaine/L-proline transport system, ATP binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 44 to 284 (241 residues), 336.5 bits, see alignment E=1e-104 PF00005: ABC_tran" amino acids 46 to 194 (149 residues), 124.5 bits, see alignment E=4.9e-40

Best Hits

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 67% identity to sil:SPO2443)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.32

Use Curated BLAST to search for 3.6.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DT29 at UniProt or InterPro

Protein Sequence (350 amino acids)

>PGA1_c25590 putative glycine betaine/L-proline transport system, ATP binding subunit (Phaeobacter inhibens DSM 17395)
MNTTKIQIRNLYKIFGANPGTVLPMVRNQGMGKSQLLEEHKHVLGLQDISIDIQAGEISV
IMGLSGSGKSTLIRHLNRLIEPTAGEILLDGQDVMDLDPVQLREMRQRSMSMVFQKFALL
PHKTVLENAETALRVRGDDRATCEAAARKWLDRVGLSGFENRYPSQLSGGMQQRVGIARA
LTADTDIMLLDEAFSALDPLIRTDMQDLLLELQTELHKTIVFITHDLDEALKLADHLVIL
KDGAVVQQGPPQGIVMNPADPYIEAFVGDINRARVLRAGTIAVTGEPEGRLAGEVDWQDT
LETVIKKAGGRADVSVSVLRDGQVAGKIEMSELMLALVPYDSQTNNSSGF