Protein Info for HP15_251 in Marinobacter adhaerens HP15

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 PF20975: DGCcoil" amino acids 5 to 68 (64 residues), 33.7 bits, see alignment E=2.4e-12 amino acids 144 to 311 (168 residues), 71.5 bits, see alignment E=7.7e-24 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 330 to 491 (162 residues), 152.2 bits, see alignment E=5.3e-49 PF00990: GGDEF" amino acids 331 to 487 (157 residues), 140.8 bits, see alignment E=3.5e-45

Best Hits

Predicted SEED Role

"FIG00784233: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PK84 at UniProt or InterPro

Protein Sequence (497 amino acids)

>HP15_251 diguanylate cyclase (Marinobacter adhaerens HP15)
MASDQSWKEKYLQELESADNREKQWKAERNTLERMLVRTSLASEGQTPELDRLLARIRKD
LRKNRVDVDAWKDLQDQIDRQVALLDERQSANDRKPSFFSRLAREPEQESQQQQQQVSAE
PLPESSEQPESLPGNEQDIEDNVQRLRIARRVGQLLGQMLTQVSLEPAAEARARALQQSL
LASNDWNELREGLNHVAELVIAAVTRSKREFEAFLKRLDERLELLKEHFSAQSSAQCGRL
DASEHLDREIREEIERVGQRLQESDDLQDLKQSVSRHLESIGQAVGRFRTQESERERALS
EQLEAMQEKVAAMEAHSEQMQEQVRKERLRAMTDLLTELPNREAWQERLSFEYNRWQRYS
HPLTIGVLDIDLFKRINDSYGHKAGDRVLQLVAREFRDRLRTTDFVARFGGEEFVVLFPE
TEPSDARAVVDKLREHVGKLPFHFRGEPVTVTFSAGLAGFIAGDTEESVFDRADRALYQA
KDAGRDQVMISDSADVQ