Protein Info for PGA1_c25580 in Phaeobacter inhibens DSM 17395

Annotation: putative glycine betaine/L-proline transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 95 to 119 (25 residues), see Phobius details amino acids 127 to 143 (17 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 214 to 231 (18 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 167 to 332 (166 residues), 79.4 bits, see alignment E=1.5e-26

Best Hits

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 77% identity to rde:RD1_2931)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F1N6 at UniProt or InterPro

Protein Sequence (343 amino acids)

>PGA1_c25580 putative glycine betaine/L-proline transport system permease protein (Phaeobacter inhibens DSM 17395)
MASYDKMFDSLGLRDWCDASLSDSPMSMSQLLTQTNGGDAGSDGSLPFPSLDALHEACGA
IPQTRDMTASVEQGFLAIKDSLKFVLDPLTQPLSWLLEGALFTFTTIPWWILIPLLVLAT
WAATRKLGVTIFVAVVFLFFGLIDHLDVALQTLSIIFVCTGLSVLFGVPVGIMMSRSDRM
QKIMLPILDMLQTLPSFVYLIPLIFLFSVTEPKLYGIAIILYAIVPVIRLTDLGIRLVDK
DVVEAADAFGMTDRQKLYGVQLPLALPNIMAGVNQTIMMSLAMVVIASLVSAPGLGVLVL
RGIRNLELGVGLVAGFGIVLLAVVLDRCSKAALQRINPAHKTD